PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00117522001
Common NameGSBRNA2T00117522001, LOC106379838
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LBD
Protein Properties Length: 133aa    MW: 14669.5 Da    PI: 7.338
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00117522001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260139.89.3e-4412110199
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +CaaCk+lrr+C++dCv+apyfp ++p kfanvh++FGasnv+k+l+++ +++red+++sl+yeAear++dPvyG+vg i+ lq+q+ +l
  GSBRNA2T00117522001  12 PCAACKFLRRRCTSDCVFAPYFPPDEPTKFANVHRIFGASNVSKILHEVAPHQREDTVNSLAYEAEARLNDPVYGCVGAISVLQRQVLKL 101
                          7***************************************************************************************** PP

               DUF260  91 kaelallke 99 
                          + el+++++
  GSBRNA2T00117522001 102 QRELEETNA 110
                          ****99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.90811112IPR004883Lateral organ boundaries, LOB
PfamPF031951.9E-4312109IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 133 aa     Download sequence    Send to blast
MASSYSNYIN SPCAACKFLR RRCTSDCVFA PYFPPDEPTK FANVHRIFGA SNVSKILHEV  60
APHQREDTVN SLAYEAEARL NDPVYGCVGA ISVLQRQVLK LQRELEETNA DLMRYASSLG  120
GEMTSNYGGQ RG*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00117522001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013618542.12e-96PREDICTED: LOB domain-containing protein 25-like
RefseqXP_013618543.12e-96PREDICTED: LOB domain-containing protein 25-like
RefseqXP_013675155.12e-96PREDICTED: LOB domain-containing protein 25-like
SwissprotQ8L8Q35e-86LBD25_ARATH; LOB domain-containing protein 25
TrEMBLA0A078ESI03e-96A0A078ESI0_BRANA; BnaC02g37020D protein
TrEMBLA0A0D3AW943e-96A0A0D3AW94_BRAOL; Uncharacterized protein
STRINGBra033019.1-P5e-95(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27650.13e-87LOB domain-containing protein 25
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]